PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 425aa    MW: 45366.2 Da    PI: 5.9202
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1674genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15e-15213267357
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  + kr+rr+ +NRe+ArrsR+RK+a++ eLe+ v +L ae ++L ++l  ++ +++
  Gh_A08G1674 213 DAKRARRMRSNRESARRSRRRKQAQMNELETQVGQLRAEHSSLLERLTDMNHKYD 267
                  68***************************************99977776666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.4E-11210265No hitNo description
SMARTSM003381.8E-17211275IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.289213268IPR004827Basic-leucine zipper domain
PfamPF001701.3E-12214267IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-10215265No hitNo description
PROSITE patternPS000360218233IPR004827Basic-leucine zipper domain
PfamPF124984.1E-18282390IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MNSVFSVDDF SDPFWAASAT GAAAGMSRSQ SEWALEKFLE EFSGAGAAIQ GSRAGENVIG  60
TSLAVPQAPV SKSENGDGDG GAVEVKKPNN LNRPPSDSTP TVPIDADEYR AILKNKLHQA  120
CAAVALSRAS VVKAEGSSAQ AENQALQSGS DVRGSSKTQE QGEPDAGISA VSTTQKKPGT  180
QMRQATSGSS REDSDDGELE GDTETTENMD PADAKRARRM RSNRESARRS RRRKQAQMNE  240
LETQVGQLRA EHSSLLERLT DMNHKYDEAA VDNRILKADI ETLRAKVKMA EETFKRVTGI  300
NPVLLSRPSV PSVTVPFVSS PLESSTGSLP LPPDTNKLFH QPVPNIAAPI HHPRLDNSFT  360
GNNLVTPIVN PQTEIGVENV NETSALQHTP RGVQKQIGPG VSPCVPMPGW EPGLPHGAAT  420
NNKQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227234RRSRRRKQ
2229234SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.96950.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476236.10.0PREDICTED: basic leucine zipper 10-like
SwissprotQ9M1G62e-73BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A0D2R2090.0A0A0D2R209_G
STRINGPOPTR_0005s23900.12e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.13e-58basic leucine zipper 25